• Home
  • Services
  • Products
  • About Us
  • Home >> Peptide Products >> Other Products >> Cys-Gly-Lys-Arg-Amyloid-ß Protein (1-42)

    Cys-Gly-Lys-Arg-Amyloid-ß Protein (1-42)

    For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.

    Catalog Number: MPE0011821

    Product Quantity: 5mg/20mg

    Price: Varies

    Availability: In Stock

    Online Inquiry

    Product Information

    Product Name: Cys-Gly-Lys-Arg-Amyloid-ß Protein (1-42)
    Molecular Formula: C220H343N63O64S2
    Molecular Weight: 4958.69
    Sequence: CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
    Three letter code: Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
    Length (aa): 46
    Peptide Purity (HPLC): >95%; 98% and 99% purity available upon request
    Quantity/Unit: 1 Vial
    * Optional Service: TFA Removal Service is available upon request.

    Technical Information

    Source: Synthetic
    Storage Guidelines: Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides
    Solubility: Soluble in water
    Appearance: Peptides are shipped at ambient temperature by standard shipment process.
    Shipping: Peptides are shipped at ambient temperature by standard shipment process.
    About TFA salt: Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.
    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.
    TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues

    Related Products / Services

    Custom Peptide Synthesis:   Cys-Gly-Lys-Arg-Amyloid-ß Protein (1-42) peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...

    Inquiry

    *
    *
    *
    Submit

    {{config.bottom.content}}