For research use only. NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE.
Catalog Number: MPE0000222
Product Quantity: 5mg/20mg
Price: Varies
Availability: In Stock
N-terminal truncation enhances peptide antimicrobial activity. It showed a moderate activity against E. coli ATCC 25922 (MIC 46.5 ug/ml) and very weak activity against S. mutans NCTC 10449, L acidophilus NCTC 1723, E. faecalis NCTC 12697, P. aeruginosa ATCC 27853, and C. albicans NCTC 3179 (MIC 125-280 ug/ml). 3D structure was determined at pH 3.2 and 37oC by 2D NMR. Residues 13-36 form a well-defined amphipathic helix. Dimers co-exist in the NMR solution. You can rotate, zoom, and view the 3D structure here in the PDB. Neuropeptide Y has Antifungal activity. The source of Neuropeptide Y is brain, Homo sapiens.
Product Name: | Neuropeptide Y |
Molecular Formula: | C189H285N55O57S |
Molecular Weight: | 4271.5 |
Sequence: | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
Three letter code: | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr |
Length (aa): | 36 |
Peptide Purity (HPLC): | >95%; 98% and 99% purity available upon request |
Quantity/Unit: | 1 Vial |
* Optional Service: | TFA Removal Service is available upon request. |
Source: | Synthetic |
Storage Guidelines: | Store at -20°C for up to 1 year. should be refrigerated after reconstitution. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides |
Solubility: | Soluble in water |
Appearance: | White to off-white powder |
Shipping: | Peptides are shipped at ambient temperature by standard shipment process. |
About TFA salt: | Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA. TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others. It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR. TFA Removal Service is recommended for: > Peptides that will be used in cellular assays > Peptides that will be used as APIs or in manufactured products > For hydrophilic peptides containing numerous basic residues |
Custom Peptide Synthesis: Neuropeptide Y peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression. Read more...
{{config.bottom.content}}